Rep78 Protein

Product Overview

• Article Name: Rep78 Protein
• Biozol Catalog Number: BYT-ORB1476959
• Supplier Catalog Number: orb1476959
• Alternative Catalog Number: BYT-ORB1476959-20,BYT-ORB1476959-100,BYT-ORB1476959-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Rep78 Protein spans the amino acid sequence from region 1-621aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 114.3 kDa
• UniProt: Q89268
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNA

Application Notes

• Application Notes: Biological Origin: Adeno-associated virus 2 (isolate Srivastava/1982) (AAV-2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel