Human CD93 Protein

Product Overview

• Article Name: Human CD93 Protein
• Biozol Catalog Number: BYT-ORB1477116
• Supplier Catalog Number: orb1477116
• Alternative Catalog Number: BYT-ORB1477116-20,BYT-ORB1477116-100,BYT-ORB1477116-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (C1q/MBL/SPA receptor)(CDw93)(Complement component 1 q subcomponent receptor 1)(Matrix-remodeling-associated protein 4)(CD_antigen, CD93)(C1qR)(C1qR(p))(C1qRp)

Product Description

This Human CD93 Protein spans the amino acid sequence from region 22-580aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 60.1 kDa
• UniProt: Q9NPY3
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCF

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 µg/mL can bind Anti-CD93 recombinant antibody, the EC50 is 0.6639-1.173 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 µg/mL can bind Human IGFBP7, the EC50 is 20.34-26.92 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 µg/ml can bind Anti-CD93 recombinant antibody, the EC50 is 0.6639-1.173 ng/mL.

Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 µg/ml can bind Human IGFBP7, the EC50 is 20.34-26.92 ng/mL.

The purity of CD93 was greater than 90% as determined by SEC-HPLC