Human CLDN4-VLPs Protein

Product Overview

• Article Name: Human CLDN4-VLPs Protein
• Biozol Catalog Number: BYT-ORB1477118
• Supplier Catalog Number: orb1477118
• Alternative Catalog Number: BYT-ORB1477118-20,BYT-ORB1477118-100,BYT-ORB1477118-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (Clostridium perfringens enterotoxin receptor)(CPE-R)(CPE-receptor)(Williams-Beuren syndrome chromosomal region 8 protein)

Product Description

This Human CLDN4-VLPs Protein spans the sequence from region 1-209aa.

Product Properties

• Molecular Weight: 23.4 kDa
• UniProt: O14493
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Source: Homo sapiens (Human)
• Form: Lyophilized powder
• Sequence: MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 µg/mL can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Images

Detected by Mouse anti-6*His monoclonal antibody.

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 µg/ml can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.