Mouse Aif1 Protein

Catalog Number: BYT-ORB1477184
Article Name: Mouse Aif1 Protein
Biozol Catalog Number: BYT-ORB1477184
Supplier Catalog Number: orb1477184
Alternative Catalog Number: BYT-ORB1477184-20,BYT-ORB1477184-100,BYT-ORB1477184-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ionized calcium-binding adapter molecule 1
This Mouse Aif1 Protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 45.7 kDa
UniProt: O70200
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Mouse Aif1 was greater than 90% as determined by SEC-HPLC