Mouse Tmprss2 Protein

Catalog Number: BYT-ORB1477588
Article Name: Mouse Tmprss2 Protein
Biozol Catalog Number: BYT-ORB1477588
Supplier Catalog Number: orb1477588
Alternative Catalog Number: BYT-ORB1477588-20, BYT-ORB1477588-100, BYT-ORB1477588-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (Epitheliasin)(Plasmic transmembrane protein X)
Recombinant Mouse Transmembrane protease serine 2(Tmprss2),partial
Molecular Weight: 48.7 kDa
UniProt: Q9JIQ8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLV
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.