Mouse Rbp4 Protein

Product Overview

• Article Name: Mouse Rbp4 Protein
• Biozol Catalog Number: BYT-ORB1477841
• Supplier Catalog Number: orb1477841
• Alternative Catalog Number: BYT-ORB1477841-1,BYT-ORB1477841-100,BYT-ORB1477841-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (Plasma retinol-binding protein)(PRBP)(RBP)

Product Description

This Mouse Rbp4 Protein spans the amino acid sequence from region 19-201aa. Purity: Greater than 94% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 50.3 kDa
• UniProt: Q00724
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Mus musculus (Mouse)
• Purity: Greater than 94% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 µg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 µg/ml can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.