Human CLDN6-VLPs Protein

Product Overview

• Article Name: Human CLDN6-VLPs Protein
• Biozol Catalog Number: BYT-ORB1478125
• Supplier Catalog Number: orb1478125
• Alternative Catalog Number: BYT-ORB1478125-20,BYT-ORB1478125-100,BYT-ORB1478125-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (Skullin)

Product Description

This Human CLDN6-VLPs Protein spans the sequence from region 1-220aa.

Product Properties

• Molecular Weight: 24.8 kDa
• UniProt: P56747
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Source: Homo sapiens (Human)
• Form: Lyophilized powder
• Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 µg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Images

Detected by Mouse anti-6*His monoclonal antibody.

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 µg/ml can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/mL

The presence of VLP-like structures was confirmed by TEM

Human CLDN6 Monoclonal Antibody captured on Protein A Chip can bind Human CLDN6 Full Length VLP Protein with an affinity constant of 6.58 nM as detected by MetaSPR Assay (WeSPRTM200).

The purity of VLPs was greater than 95% as determined by SEC-HPLC