Human CLDN6-VLPs Protein
Catalog Number:
BYT-ORB1478125
- Images (5)
| Article Name: | Human CLDN6-VLPs Protein |
| Biozol Catalog Number: | BYT-ORB1478125 |
| Supplier Catalog Number: | orb1478125 |
| Alternative Catalog Number: | BYT-ORB1478125-20,BYT-ORB1478125-100,BYT-ORB1478125-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | (Skullin) |
| This Human CLDN6-VLPs Protein spans the sequence from region 1-220aa. |
| Molecular Weight: | 24.8 kDa |
| UniProt: | P56747 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Source: | Homo sapiens (Human) |
| Form: | Lyophilized powder |
| Sequence: | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 µg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing |





