Human H2AFX Protein

Catalog Number: BYT-ORB1478151
Article Name: Human H2AFX Protein
Biozol Catalog Number: BYT-ORB1478151
Supplier Catalog Number: orb1478151
Alternative Catalog Number: BYT-ORB1478151-1,BYT-ORB1478151-100,BYT-ORB1478151-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Histone H2A.X
This Human H2AFX Protein spans the amino acid sequence from region 12-141aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 17.8 kDa
UniProt: P16104
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQ
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) H2AFX, H2AX.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) H2AFX, H2AX.