Human Complement C3 Protein
Catalog Number:
BYT-ORB1478159
- Images (3)
| Article Name: | Human Complement C3 Protein |
| Biozol Catalog Number: | BYT-ORB1478159 |
| Supplier Catalog Number: | orb1478159 |
| Alternative Catalog Number: | BYT-ORB1478159-20,BYT-ORB1478159-100,BYT-ORB1478159-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 |
| This Human Complement C3 Protein spans the amino acid sequence from region 26-225aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 26.4 kDa |
| UniProt: | P01024 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



