Recombinant Mouse Granzyme K (Gzmk)

Catalog Number: BYT-ORB1674329
Article Name: Recombinant Mouse Granzyme K (Gzmk)
Biozol Catalog Number: BYT-ORB1674329
Supplier Catalog Number: orb1674329
Alternative Catalog Number: BYT-ORB1674329-20,BYT-ORB1674329-100,BYT-ORB1674329-500,BYT-ORB1674329-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Mouse
Recombinant Mouse Granzyme K(Gzmk)
Molecular Weight: 29.2 kDa
UniProt: O35205
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAPSRAH
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration