Recombinant Human Cell adhesion molecule 1 (CADM1), partial (Active)

Product Overview

• Article Name: Recombinant Human Cell adhesion molecule 1 (CADM1), partial (Active)
• Biozol Catalog Number: BYT-ORB1785086
• Supplier Catalog Number: orb1785086
• Alternative Catalog Number: BYT-ORB1785086-20,BYT-ORB1785086-100,BYT-ORB1785086-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cell adhesion molecule 1 , Immunoglobulin superfamily member 4, IgSF4, Nectin-like protein 2, NECL-2, Spermatogenic immunoglobulin superfamily, SgIgSF, Synaptic cell adhesion molecule, SynCAM, Tumor suppressor in lung cancer 1, TSLC-1

Product Description

This Recombinant Human Cell adhesion molecule 1 (CADM1), partial (Active) spans the amino acid sequence from region 45-374aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 38.5 kDa
• UniProt: Q9BY67
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLF

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CADM1 at 2 µg/mL can bind Human CRTAM, the EC50 is 17.82-21.71 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CADM1 at 2µg/mL can bind Human CRTAM, the EC50 is 17.82-21.71 ng/mL.