Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

Product Overview

• Article Name: Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
• Biozol Catalog Number: BYT-ORB1785093
• Supplier Catalog Number: orb1785093
• Alternative Catalog Number: BYT-ORB1785093-20,BYT-ORB1785093-100,BYT-ORB1785093-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) spans the amino acid sequence from region 20-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 11.7 kDa
• UniProt: Q6MG58
• Buffer: Lyophilized from a 0.2 µm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Rattus norvegicus (Rat)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN

Application Notes

• Application Notes: Biological Origin: Rattus norvegicus (Rat). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 5 µg/mL can bind Anti-LY6G6D recombinant antibody. The EC50 is 4.245-5.843 µg/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 µg/ml can bind Anti-Ly6g6d recombinant antibody. The EC50 is 6.238-7.258 ng/mL.

The purity of Ly6g6d was greater than 95% as determined by SEC-HPLC