Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B) (Active)

Catalog Number: BYT-ORB1785277
Article Name: Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B) (Active)
Biozol Catalog Number: BYT-ORB1785277
Supplier Catalog Number: orb1785277
Alternative Catalog Number: BYT-ORB1785277-1,BYT-ORB1785277-100,BYT-ORB1785277-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B) (Active) spans the amino acid sequence from region 23-169aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 17.6 kDa
UniProt: G7Q0A1
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT
Application Notes: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ZG16B at 2 µg/mL can bind Anti-ZG16B recombinant antibody, the EC50 is 20.15-28.98 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ZG16B at 2µg/mL can bind Anti-ZG16B recombinant antibody, the EC50 is 20.15-28.98 ng/mL.