Recombinant Human CD70 antigen (CD70), partial (Active)

Catalog Number: BYT-ORB1785281
Article Name: Recombinant Human CD70 antigen (CD70), partial (Active)
Biozol Catalog Number: BYT-ORB1785281
Supplier Catalog Number: orb1785281
Alternative Catalog Number: BYT-ORB1785281-1,BYT-ORB1785281-100,BYT-ORB1785281-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (CD27 ligand)(CD27-L)(CD27L)(CD27LG)(TNFSF7)
This Recombinant Human CD70 antigen (CD70), partial (Active) spans the amino acid sequence from region 52-193aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.7 kDa
UniProt: P32970
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 µg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb1785281
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced/non-reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 µg/ml can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.