Recombinant Human Leukemia inhibitory factor (LIF) (Active)

Catalog Number: BYT-ORB1785348
Article Name: Recombinant Human Leukemia inhibitory factor (LIF) (Active)
Biozol Catalog Number: BYT-ORB1785348
Supplier Catalog Number: orb1785348
Alternative Catalog Number: BYT-ORB1785348-1,BYT-ORB1785348-100,BYT-ORB1785348-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (LIF)(Differentiation-stimulating factor)(D factor)(Melanoma-derived LPL inhibitor)(MLPLI)(Emfilermin)
This Recombinant Human Leukemia inhibitory factor (LIF) spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 23.1 kDa
UniProt: P15018
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LIF at 2 µg/mL can bind Human LIFR protein. The EC50 is 8.067-9.260 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human LIF at 2 µg/ml can bind Human LIFR protein. The EC50 is 8.067-9.260 ng/mL.