AKR1B10 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: AKR1B10 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB18528
• Supplier Catalog Number: orb18528
• Alternative Catalog Number: BYT-ORB18528-10,BYT-ORB18528-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
• Conjugation: Unconjugated
• Alternative Names: Aldo-keto reductase family 1 member B10,1.1.1.-,ARL-1,Aldose reductase-like,Aldose reductase-related protein,ARP,hARP,Small intestine reductase,SI reductase,AKR1B10,AKR1B11,

Product Description

AKR1B10 Antibody

Product Properties

• Clonality: Polyclonal
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molecular Weight: 36020 MW
• UniProt: O60218
• Form: Lyophilized

Application Notes

• Application Dilute: Western blot, 0.1-0.5µg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5 µg/ml, Human
• Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal d