Recombinant Human Glypican-3 (GPC3) (S359F), partial (Active)

Catalog Number: BYT-ORB1881655
Article Name: Recombinant Human Glypican-3 (GPC3) (S359F), partial (Active)
Biozol Catalog Number: BYT-ORB1881655
Supplier Catalog Number: orb1881655
Alternative Catalog Number: BYT-ORB1881655-1,BYT-ORB1881655-100,BYT-ORB1881655-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: OCI5
This Recombinant Human Glypican-3 (GPC3)(S359F), partial (Active) spans the amino acid sequence from region 25-559aa(S359F). Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 62.2 kDa
UniProt: P51654
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCN
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Loaded Anti-Human GPC3 Antibody on 96-Flat plate, can bind Human GPC3 (S359F), with an affinity constant of 6.32 nM as determined in BLI assay (Gator Prime). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Loaded Anti-Human GPC3 Antibody on 96-Flat plate, can bind Human GPC3 (S359F), with an affinity constant of 6.32 nM as determined in BLI assay (Gator Prime).