Recombinant Human Vascular endothelial growth factor A (VEGFA), Biotinylated

Catalog Number: BYT-ORB1881661
Article Name: Recombinant Human Vascular endothelial growth factor A (VEGFA), Biotinylated
Biozol Catalog Number: BYT-ORB1881661
Supplier Catalog Number: orb1881661
Alternative Catalog Number: BYT-ORB1881661-1,BYT-ORB1881661-100,BYT-ORB1881661-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: VEGF-A,Vascular permeability factor,VPF
This Recombinant Human Vascular endothelial growth factor A (VEGFA), Biotinylated spans the amino acid sequence from region 27-191aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 22.7 kDa
UniProt: P15692
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of VEGFA was greater than 90% as determined by SEC-HPLC