Recombinant Human Dipeptidase 3 (DPEP3), partial (Active)

Product Overview

• Article Name: Recombinant Human Dipeptidase 3 (DPEP3), partial (Active)
• Biozol Catalog Number: BYT-ORB1881860
• Supplier Catalog Number: orb1881860
• Alternative Catalog Number: BYT-ORB1881860-20,BYT-ORB1881860-100,BYT-ORB1881860-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: UNQ834,PRO1772

Product Description

This Recombinant Human Dipeptidase 3 (DPEP3), partial (Active) spans the amino acid sequence from region 36-463aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 48.3 kDa
• UniProt: Q9H4B8
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSH

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 µg/mL can bind Anti-DPEP3 recombinant antibody.The EC50 is 6.841-7.498 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2µg/mL can bind Anti-DPEP3 recombinant antibody, the EC50 is 6.841-7.498 ng/mL.

The purity of DPEP3 was greater than 95% as determined by SEC-HPLC