SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc)

Product Overview

• Article Name: SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc)
• Biozol Catalog Number: BYT-ORB1976429
• Supplier Catalog Number: orb1976429
• Alternative Catalog Number: BYT-ORB1976429-20,BYT-ORB1976429-100,BYT-ORB1976429-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: sars-cov-2

Product Description

SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc) is expressed in HEK293 mammalian cells with C-hFC-Flag tag. The predicted molecular weight is 44.5 kDa and the accession number is P0DTD1 YP_009742616.1.

Product Properties

• Molecular Weight: 44.5 kDa (predicted)
• UniProt: P0DTD1
• Source: SARS-CoV-2
• Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Application Notes

• Application Notes: Biological Origin: SARS-CoV-2