SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His)

Product Overview

• Article Name: SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His)
• Biozol Catalog Number: BYT-ORB1976431
• Supplier Catalog Number: orb1976431
• Alternative Catalog Number: BYT-ORB1976431-20,BYT-ORB1976431-100,BYT-ORB1976431-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: sars-cov-2

Product Description

SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 41.7 kDa and the accession number is YP_009725299.1.

Product Properties

• Molecular Weight: 41.7 kDa (predicted)
• Source: SARS-CoV-2
• Sequence: EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKH

Application Notes

• Application Notes: Biological Origin: SARS-CoV-2