ACE2 Protein, Paguma larvata, Recombinant (hFc)

Product Overview

• Article Name: ACE2 Protein, Paguma larvata, Recombinant (hFc)
• Biozol Catalog Number: BYT-ORB1976839
• Supplier Catalog Number: orb1976839
• Alternative Catalog Number: BYT-ORB1976839-1,BYT-ORB1976839-20,BYT-ORB1976839-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

ACE2 Protein, Paguma larvata, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 112.7 kDa and the accession number is Q56NL1.

Product Properties

• Molecular Weight: 112.7 kDa (predicted)
• UniProt: Q56NL1
• Source: Paguma larvata
• Purity: Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC.
• Sequence: QSTTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITDENAKNMNEAGAKWSAYYEEQSKLAQTYPLAEIQDAKIKRQLQALQQSGSSVLSADKSQRLNTILNAMSTIYSTGKACNPNNPQECLLLEPGLDNIMENSKDYNERLWAWEGWRAEVGKQLRPLYEEYVALKNEMARANNYEDYGDYWRGDYEEEWTGGYNYSRNQLIQDVEDTFEQIKPLYQHLHAYVRAKLMDTYPSRISRTGCLPAHLLGDMWG

Application Notes

• Application Notes: Biological Origin: Paguma larvata