TMPRSS2 Protein, Human, Recombinant (Avi & His & MBP), Biotinylated

Catalog Number: BYT-ORB1977680
Article Name: TMPRSS2 Protein, Human, Recombinant (Avi & His & MBP), Biotinylated
Biozol Catalog Number: BYT-ORB1977680
Supplier Catalog Number: orb1977680
Alternative Catalog Number: BYT-ORB1977680-20, BYT-ORB1977680-100, BYT-ORB1977680-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
TMPRSS2 Protein, Human, Recombinant (Avi & His & MBP), Biotinylated is expressed in E. coli expression system with N-MBP and C-6xHis-Avi tag. The predicted molecular weight is 90.6 kDa and the accession number is O15393.
Molecular Weight: 90.6 kDa (predicted)
UniProt: O15393
Source: Human
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
Application Notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.