TMPRSS2 Protein, Human, Recombinant (Avi & His & MBP), Biotinylated

Product Overview

• Article Name: TMPRSS2 Protein, Human, Recombinant (Avi & His & MBP), Biotinylated
• Biozol Catalog Number: BYT-ORB1977680
• Supplier Catalog Number: orb1977680
• Alternative Catalog Number: BYT-ORB1977680-20,BYT-ORB1977680-100,BYT-ORB1977680-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

TMPRSS2 Protein, Human, Recombinant (Avi & His & MBP), Biotinylated is expressed in E. coli expression system with N-MBP and C-6xHis-Avi tag. The predicted molecular weight is 90.6 kDa and the accession number is O15393.

Product Properties

• Molecular Weight: 90.6 kDa (predicted)
• UniProt: O15393
• Source: Human
• Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL

Application Notes

• Application Notes: Biological Origin: Human