DSEL Peptide - C-terminal region

Product Overview

• Article Name: DSEL Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB1997463
• Supplier Catalog Number: orb1997463
• Alternative Catalog Number: BYT-ORB1997463-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: C18orf4, DE-epi2

Product Description

DSEL Peptide - C-terminal region

Product Properties

• NCBI: 115536
• UniProt: Q8IZU8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: MFAFSTFEESVSNYSEWAVFTDDIDQFKTQKVQDFRPNQKLKKSMLHPSL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DSEL Rabbit Polyclonal Antibody (orb635620). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings