TRPM3 Peptide - middle region

Product Overview

• Article Name: TRPM3 Peptide - middle region
• Biozol Catalog Number: BYT-ORB1997472
• Supplier Catalog Number: orb1997472
• Alternative Catalog Number: BYT-ORB1997472-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: GON-2, MLSN2, LTRPC3

Product Description

TRPM3 Peptide - middle region

Product Properties

• NCBI: 996827
• UniProt: Q9HCF6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: VACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQ

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TRPM3 Rabbit Polyclonal Antibody (orb635618). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings