FAM40A Peptide - C-terminal region

Product Overview

• Article Name: FAM40A Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB1997474
• Supplier Catalog Number: orb1997474
• Alternative Catalog Number: BYT-ORB1997474-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: FAM40A, FAR11A

Product Description

FAM40A Peptide - C-terminal region

Product Properties

• NCBI: 149079
• UniProt: Q5VSL9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: YSYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with FAM40A Rabbit Polyclonal Antibody (orb635625). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings