TMC3 Peptide - N-terminal region

Product Overview

• Article Name: TMC3 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997475
• Supplier Catalog Number: orb1997475
• Alternative Catalog Number: BYT-ORB1997475-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

TMC3 Peptide - N-terminal region

Product Properties

• NCBI: 001074001
• UniProt: Q7Z5M5
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EGHLERPAYVPRKPRSRNFQYPQPPLKPRGKPRFEPSLTESDSVSAASSS

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TMC3 Rabbit Polyclonal Antibody (orb635624). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings