TTLL3 Peptide - N-terminal region

Product Overview

• Article Name: TTLL3 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997477
• Supplier Catalog Number: orb1997477
• Alternative Catalog Number: BYT-ORB1997477-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: HOTTL

Product Description

TTLL3 Peptide - N-terminal region

Product Properties

• NCBI: 001021100
• UniProt: Q9Y4R7
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LKPLPLVGTFQRRRGLGDMKLGKPLLRFPTALVLDPTPNKKKQVKYLGLD

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TTLL3 Rabbit Polyclonal Antibody (orb635622). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings