ANO5 Peptide - N-terminal region

Product Overview

• Article Name: ANO5 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997480
• Supplier Catalog Number: orb1997480
• Alternative Catalog Number: BYT-ORB1997480-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: GDD1, LGMD2L, TMEM16E

Product Description

ANO5 Peptide - N-terminal region

Product Properties

• NCBI: 998764
• UniProt: Q75V66
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEKI

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ANO5 Rabbit Polyclonal Antibody (orb586528). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings