UBA6 Peptide - C-terminal region

Product Overview

• Article Name: UBA6 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB1997481
• Supplier Catalog Number: orb1997481
• Alternative Catalog Number: BYT-ORB1997481-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: E1-L2, MOP-4, UBE1L2

Product Description

UBA6 Peptide - C-terminal region

Product Properties

• NCBI: 060697
• UniProt: A0AVT1
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKS

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with UBA6 Rabbit Polyclonal Antibody (orb584317). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings