GBA2 Peptide - middle region

Product Overview

• Article Name: GBA2 Peptide - middle region
• Biozol Catalog Number: BYT-ORB1997482
• Supplier Catalog Number: orb1997482
• Alternative Catalog Number: BYT-ORB1997482-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: AD035, SPG46, NLGase

Product Description

GBA2 Peptide - middle region

Product Properties

• NCBI: 065995
• UniProt: Q9HCG7
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with GBA2 Rabbit Polyclonal Antibody (orb583585). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings