IFT122 Peptide - middle region

Product Overview

• Article Name: IFT122 Peptide - middle region
• Biozol Catalog Number: BYT-ORB1997483
• Supplier Catalog Number: orb1997483
• Alternative Catalog Number: BYT-ORB1997483-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CED, SPG, CED1, WDR10, WDR10p, WDR140

Product Description

IFT122 Peptide - middle region

Product Properties

• NCBI: 443715
• UniProt: Q9HBG6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: QDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with IFT122 Rabbit Polyclonal Antibody (orb582239). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings