DIS3L Peptide - C-terminal region

Product Overview

• Article Name: DIS3L Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB1997485
• Supplier Catalog Number: orb1997485
• Alternative Catalog Number: BYT-ORB1997485-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: DIS3L1

Product Description

DIS3L Peptide - C-terminal region

Product Properties

• NCBI: 588616
• UniProt: Q8TF46
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: NNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DIS3L Rabbit Polyclonal Antibody (orb577903). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings