MYBBP1A Peptide - N-terminal region

Product Overview

• Article Name: MYBBP1A Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997488
• Supplier Catalog Number: orb1997488
• Alternative Catalog Number: BYT-ORB1997488-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: P160, PAP2, Pol5

Product Description

MYBBP1A Peptide - N-terminal region

Product Properties

• NCBI: 055335
• UniProt: Q9BQG0
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MYBBP1A Rabbit Polyclonal Antibody (orb576963). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings