CEBPZ Peptide - N-terminal region

Product Overview

• Article Name: CEBPZ Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997489
• Supplier Catalog Number: orb1997489
• Alternative Catalog Number: BYT-ORB1997489-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CBF, CBF2, NOC1, HSP-CBF

Product Description

CEBPZ Peptide - N-terminal region

Product Properties

• NCBI: 005751
• UniProt: Q03701
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with CEBPZ Rabbit Polyclonal Antibody (orb576786). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings