Synthetic peptide located within the following region: SFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLP
Application Notes:
This is a synthetic peptide designed for use in combination with TMPRSS2 Rabbit Polyclonal Antibody (orb589600). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
* VAT and and shipping costs not included. Errors and price changes excepted