TMPRSS2 Peptide - middle region

Product Overview

• Article Name: TMPRSS2 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2000137
• Supplier Catalog Number: orb2000137
• Alternative Catalog Number: BYT-ORB2000137-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: PP9284, PRSS10

Product Description

TMPRSS2 Peptide - middle region

Product Properties

• Molecular Weight: 54 kDa
• NCBI: 001128571
• UniProt: O15393
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLP

Application Notes

• Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS2 Rabbit Polyclonal Antibody (orb589600). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.