S100A5 Peptide - N-terminal region

Product Overview

• Article Name: S100A5 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2002656
• Supplier Catalog Number: orb2002656
• Alternative Catalog Number: BYT-ORB2002656-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: S100D

Product Description

S100A5 Peptide - N-terminal region

Product Properties

• Molecular Weight: 10kDa
• UniProt: P33763
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESS

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with S100A5 Rabbit Polyclonal Antibody (orb326108). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings