MKLN1 Peptide - N-terminal region

Product Overview

• Article Name: MKLN1 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004108
• Supplier Catalog Number: orb2004108
• Alternative Catalog Number: BYT-ORB2004108-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: TWA2

Product Description

MKLN1 Peptide - N-terminal region

Product Properties

• NCBI: 037387
• UniProt: Q9UL63
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MKLN1 Rabbit Polyclonal Antibody (orb583289). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings