GNA12 Peptide - C-terminal region

Product Overview

• Article Name: GNA12 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004110
• Supplier Catalog Number: orb2004110
• Alternative Catalog Number: BYT-ORB2004110-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: NNX3, RMP, gep

Product Description

GNA12 Peptide - C-terminal region

Product Properties

• NCBI: 031379
• UniProt: Q03113
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with GNA12 Rabbit Polyclonal Antibody (orb582496). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings