ACSM2A Peptide - middle region

Product Overview

• Article Name: ACSM2A Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004126
• Supplier Catalog Number: orb2004126
• Alternative Catalog Number: BYT-ORB2004126-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

ACSM2A Peptide - middle region

Product Properties

• UniProt: F5H4B8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: WRAQTGLDIRESYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQIIDDK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ACSM2A Rabbit Polyclonal Antibody (orb579561). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings