ART3 Peptide - N-terminal region

Product Overview

• Article Name: ART3 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004128
• Supplier Catalog Number: orb2004128
• Alternative Catalog Number: BYT-ORB2004128-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ARTC3

Product Description

ART3 Peptide - N-terminal region

Product Properties

• NCBI: 001170
• UniProt: Q13508
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: QTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASS

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ART3 Rabbit Polyclonal Antibody (orb579380). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings