HACE1 Peptide - N-terminal region

Product Overview

• Article Name: HACE1 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004136
• Supplier Catalog Number: orb2004136
• Alternative Catalog Number: BYT-ORB2004136-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

HACE1 Peptide - N-terminal region

Product Properties

• NCBI: 065822
• UniProt: Q8IYU2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with HACE1 Rabbit Polyclonal Antibody (orb578776). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings