MED6 Peptide - N-terminal region

Product Overview

• Article Name: MED6 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004141
• Supplier Catalog Number: orb2004141
• Alternative Catalog Number: BYT-ORB2004141-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: NY-REN-28

Product Description

MED6 Peptide - N-terminal region

Product Properties

• NCBI: 005457
• UniProt: O75586
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MED6 Rabbit Polyclonal Antibody (orb576767). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings