RFX4 Peptide - N-terminal region

Product Overview

• Article Name: RFX4 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004149
• Supplier Catalog Number: orb2004149
• Alternative Catalog Number: BYT-ORB2004149-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: NYD-SP10

Product Description

RFX4 Peptide - N-terminal region

Product Properties

• NCBI: 998759
• UniProt: Q33E94
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIM

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with RFX4 Rabbit Polyclonal Antibody (orb574564). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings