SIX4 Peptide - middle region

Product Overview

• Article Name: SIX4 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004152
• Supplier Catalog Number: orb2004152
• Alternative Catalog Number: BYT-ORB2004152-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

SIX4 Peptide - middle region

Product Properties

• UniProt: G3V2N2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDRNP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SIX4 Rabbit Polyclonal Antibody (orb324418). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings