OSR1 Peptide - N-terminal region

Product Overview

• Article Name: OSR1 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004153
• Supplier Catalog Number: orb2004153
• Alternative Catalog Number: BYT-ORB2004153-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ODD

Product Description

OSR1 Peptide - N-terminal region

Product Properties

• NCBI: 660303
• UniProt: Q8TAX0
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OSR1 Rabbit Polyclonal Antibody (orb574095). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings