AKAP8L Peptide - C-terminal region

Product Overview

• Article Name: AKAP8L Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004156
• Supplier Catalog Number: orb2004156
• Alternative Catalog Number: BYT-ORB2004156-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: HA95, HAP95, NAKAP, NAKAP95

Product Description

AKAP8L Peptide - C-terminal region

Product Properties

• NCBI: 055186
• UniProt: Q9ULX6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: NNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with AKAP8L Rabbit Polyclonal Antibody (orb329625). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings