TCF7 Peptide - C-terminal region

Product Overview

• Article Name: TCF7 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004157
• Supplier Catalog Number: orb2004157
• Alternative Catalog Number: BYT-ORB2004157-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: TCF-1

Product Description

TCF7 Peptide - C-terminal region

Product Properties

• NCBI: 998813
• UniProt: P36402
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDNSLHYS

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TCF7 Rabbit Polyclonal Antibody (orb573792). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings