NKX6-2 Peptide - N-terminal region

Product Overview

• Article Name: NKX6-2 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004159
• Supplier Catalog Number: orb2004159
• Alternative Catalog Number: BYT-ORB2004159-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: GTX, NKX6.2, NKX6B

Product Description

NKX6-2 Peptide - N-terminal region

Product Properties

• NCBI: 796374
• UniProt: Q9C056
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with NKX6-2 Rabbit Polyclonal Antibody (orb573563). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings