PUS7L Peptide - N-terminal region

Product Overview

• Article Name: PUS7L Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004165
• Supplier Catalog Number: orb2004165
• Alternative Catalog Number: BYT-ORB2004165-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

PUS7L Peptide - N-terminal region

Product Properties

• NCBI: 112582
• UniProt: Q9H0K6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PUS7L Rabbit Polyclonal Antibody (orb587728). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings